PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G16780.1
Common NameATHB2, ATHB-2, dl4415w, FCAALL.101, HAT4, HB-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 284aa    MW: 31852.5 Da    PI: 9.0241
Description homeobox protein 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G16780.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.9e-19128182256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q  +Lee F+ +++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  AT4G16780.1 128 RKKLRLSKDQSAILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTK 182
                  788899***********************************************98 PP

2HD-ZIP_I/II124.35.5e-40128217191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEe+F+ +++L+p++K++la++Lgl++rqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+kev+eLr +l
  AT4G16780.1 128 RKKLRLSKDQSAILEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTKLKQTEVDCEFLRRCCENLTEENRRLQKEVTELR-AL 217
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.0E-302107IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.2E-18115178IPR009057Homeodomain-like
PROSITE profilePS5007117.427124184IPR001356Homeobox domain
SuperFamilySSF466894.28E-18126193IPR009057Homeodomain-like
SMARTSM003895.2E-16126188IPR001356Homeobox domain
PfamPF000467.7E-17128182IPR001356Homeobox domain
CDDcd000865.70E-15128185No hitNo description
PRINTSPR000311.1E-5155164IPR000047Helix-turn-helix motif
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5164180IPR000047Helix-turn-helix motif
PfamPF021838.3E-11184218IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.8E-26184227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009585Biological Processred, far-red light phototransduction
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MMFEKDDLGL SLGLNFPKKQ INLKSNPSVS VTPSSSSFGL FRRSSWNESF TSSVPNSDSS  60
QKETRTFIRG IDVNRPPSTA EYGDEDAGVS SPNSTVSSST GKRSEREEDT DPQGSRGISD  120
DEDGDNSRKK LRLSKDQSAI LEETFKDHST LNPKQKQALA KQLGLRARQV EVWFQNRRAR  180
TKLKQTEVDC EFLRRCCENL TEENRRLQKE VTELRALKLS PQFYMHMSPP TTLTMCPSCE  240
HVSVPPPQPQ AATSAHHRSL PVNAWAPATR ISHGLTFDAL RPRS